Prolactin Releasing Peptide (1-31), human | SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2|235433-36-0
- FOB Price:Get Latest Price >
- Min.Order:1 Vial(s)
- Payment Terms:L/C , T/T , Others
- Favorite
Business Type:Manufacturer
Country/Region:China
Ddu Verified
HOT Rank

